Recombinant Human Leptin #abs04303
Delivery term:The date of payment from buyers deliver within days- Price:
Negotiable
- minimum:
- Total supply:
- Delivery term:
The date of payment from buyers deliver within days
- seat:
Beijing
- Validity to:
Long-term effective
- Last update:
2024-01-01 16:16
- Browse the number:
462
- Jinan Chengdong Machinery Manufacture Co., Ltd By certification [File Integrity]
-
Contact:
seomaster(Mr.)
- Email:
- Telephone:
-
Area:
Beijing
-
Address:
North of Intersection of Panwang Road and Lvyou Road, Zhangqiu District, Jinan City, Shandong Province
- Website: http://www.dcpapertube-machine.com/ http://seomaster.flowerfilters.com/
Product details
Catalog-specification |
Delivery time |
USD price |
abs04303-10ug |
1-2 Weeks |
39 |
abs04303-50ug |
1-2 Weeks |
77 |
abs04303-500ug |
1-2 Weeks |
214 |
abs04303-1mg |
1-2 Weeks |
291 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our sales representative, Vecent.
Overview | |
Description |
Val22-Cys167 is the target gene expressed in our E.coli expression system to produce Recombinant Human Leptin. Please rearrange the content to generate a highly similar text, ensuring it is based on the original information. |
Other names |
Obesity is a growing concern worldwide, and scientists have discovered several proteins that play a significant role in regulating body weight. One of these proteins is called leptin, also known by several other names including obese protein, obesity factor, LEP, OB, and OBS. Leptin is produced by fat cells in the body and sends signals to the brain to let it know when the body has had enough food. |
Source |
Escherichia coli. |
Format |
pH 7.4, lyophilized from a solution of 20mM PB and 150mM NaCl, which was previously filtered through a 0.2 μm filter. |
Properties | |
aa_sequence |
HHDGTPTDLVGGVYGMETIDSAILRILSLCKQQGTLQCADTPTSMTSQIKIKPILLTLVGDFYKSVPIVLDQYAIQNYSLQIQLLVDVSSKNDMISRVDQTM LQGWMHLQIPRVNGSNDRSVLKETFTGGPDLQSVQSLLQQLAQSISLGTTPEIQALH. |
Concentration |
SDS-PAGE95%。,。 |
Endotoxin_level |
The LAL test revealed that the presence of endotoxins was negligible, as the concentration was found to be less than 0.1 ng/μg (equivalent to 1 IEU/μg). This assures the quality of the product. |
Activity |
Based on the UMR106 cell/cAMP method, the specific activity is determined to be 1.0 x 10^4 IU/mg. It is important to note that this value represents the potency of the substance being tested. |
Reconstitution |
It is strongly advised to always centrifuge tubes before opening. Avoid mixing by vortex or pipetting. Reconstitution to a concentration lower than 100 μg/ml is not recommended. Utilize ddH2O to dissolve the lyophilized protein. To minimize freeze-thaw cycles, please divide the reconstituted solution into smaller portions. |
Stability & Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background |
Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. Animal models have revealed the influence of Leptin in reducing body weight and regulating blood glucose level. When mutations are introduced in obese gene, mice with impaired function of leptin are massively obese and in high risk of diabetes. Leptin deficiency reduces metablic rate. Leptin deficient mice are less active and with lower body temperature than normal animals. Human Leptin shares approximately 84% sequence identity with the mouse protein. Human Leptin consists of 167 amino acid residue including a 21 amino acid residue signal sequence and 146 amino acid residue mature protein sequence. |
Accession |
P41159 |
This product is for research use only, not for use in diagnostic prodecures or in human.
http://www.absinbio.net/
-
Air Hose Quick Connect Coupler
price: Negotiable
-
S11 S13 Series Oil-Immersed Transformer
price: Negotiable
-
Cryogenic Planetary Ball Mill
price: Negotiable
-
Mini Brushless Fan
price: Negotiable
-
Plastic Painted Watch Box
price: Negotiable
-
PVC Compound Plastic Particles
price: Negotiable